DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retinin and CG4982

DIOPT Version :9

Sequence 1:NP_524995.2 Gene:retinin / 53564 FlyBaseID:FBgn0040074 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_648866.1 Gene:CG4982 / 39794 FlyBaseID:FBgn0036598 Length:113 Species:Drosophila melanogaster


Alignment Length:83 Identity:28/83 - (33%)
Similarity:37/83 - (44%) Gaps:18/83 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EPAVAKVGEVVQHVPTAVSHQTQTVVHDHR---RLV---TPIVAPAVRTTQVIRQQP-------- 174
            |.|.:.||.....:|.|||||:.||||:.|   |.:   |||:..|......|...|        
  Fly    30 EYAPSVVGYESYALPAAVSHQSSTVVHEKRPYWRPIVDHTPILKAAYAPATSISYAPLGYAGNSA 94

  Fly   175 ----PLLWSVASDPRVVL 188
                |.:|.|:|.|.:.|
  Fly    95 GWYEPGIWGVSSYPSIYL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retininNP_524995.2 Retinin_C 122..>169 CDD:309599 20/50 (40%)
CG4982NP_648866.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.