powered by:
Protein Alignment retinin and CG4239
DIOPT Version :9
Sequence 1: | NP_524995.2 |
Gene: | retinin / 53564 |
FlyBaseID: | FBgn0040074 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285325.1 |
Gene: | CG4239 / 32606 |
FlyBaseID: | FBgn0030745 |
Length: | 276 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 15/62 - (24%) |
Similarity: | 24/62 - (38%) |
Gaps: | 5/62 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 NGLRTVLTIQEPAVAKVGEVVQHVPTAVSHQTQTVVH-----DHRRLVTPIVAPAVRTTQVI 170
:.|...|.::|...|......:..|.|....|..|:. .:..|..||:||...|.|::
Fly 26 HSLLAALAVREDLGANAQAFSRKHPLACWLSTMLVIFAGGMVANGLLGEPILAPLKNTGQLL 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3944 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.