DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gukh and wasf2

DIOPT Version :9

Sequence 1:NP_732393.1 Gene:gukh / 53563 FlyBaseID:FBgn0026239 Length:1788 Species:Drosophila melanogaster
Sequence 2:NP_001315119.1 Gene:wasf2 / 394056 ZFINID:ZDB-GENE-040426-865 Length:486 Species:Danio rerio


Alignment Length:341 Identity:71/341 - (20%)
Similarity:122/341 - (35%) Gaps:100/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 EFDSISNITLSNALRQLASLVLIASDIFDDLQRDLQAVGERAGRVQRKIAAVERRVCAYDPKTVT 202
            |.:.::||||:|.:|||.||...|.|:|.:|........:|...:..::..::.:|...|||.  
Zfish    25 ELECVTNITLANIIRQLGSLSKYAEDVFGELFVQASKFADRVTTLGERVDKLQVKVTQLDPKE-- 87

  Fly   203 VPESDLLTFAQRKHHFETDKSFQQELFTGETRPLSVRQLYTEAGKELPVATGATATALASLAHSQ 267
             .|..|.....|| .|.::....|:||...:.|..:...|....:..|:               .
Zfish    88 -EEVSLQAITSRK-AFHSNLIQDQQLFIRASLPQPINDTYLTCDQPPPL---------------D 135

  Fly   268 SLIPSRSISFNGEVLSSD---------HEVLQLNGSTDTED-------HLLCVSDFGNAN----- 311
            .|.|.|..........:|         .::||     ||:|       |.....|  |.|     
Zfish   136 KLSPYREDGKEALKFYTDPSYFFDLWKEKMLQ-----DTKDIIKEKRKHKKKKDD--NVNRRNLN 193

  Fly   312 -RKLRTRIDAEIEIRLPAAIEDLRKWTSSEALGDVTVTP--DCMHHVDTSVSTSLAIGENGILTP 373
             ||::||.|               :| ..:.:|...|.|  |.:.:...:::.|:..|::|    
Zfish   194 PRKIKTRKD---------------EW-ERQKMGAEFVVPKTDALGNSSEALNGSIGSGDDG---- 238

  Fly   374 ALSPSVLSADAVDALYAQNLSQAADSSRHNHHTQALIPNDINKDVPLNHRLPSPEEQTKQIALKY 438
                 .:..|:.       |.|:.:|  :::...:.:|....:|.|     |.|           
Zfish   239 -----YMHTDSY-------LEQSTNS--YSYDPGSPLPPPAQEDFP-----PPP----------- 273

  Fly   439 PAEVISVNTSGKHFQR 454
            ||:.....:.|.|.:|
Zfish   274 PADTQYNESGGAHTKR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gukhNP_732393.1 NHS <818..>846 CDD:291922
wasf2NP_001315119.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12902
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.