DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gukh and WASF3

DIOPT Version :9

Sequence 1:NP_732393.1 Gene:gukh / 53563 FlyBaseID:FBgn0026239 Length:1788 Species:Drosophila melanogaster
Sequence 2:NP_006637.2 Gene:WASF3 / 10810 HGNCID:12734 Length:502 Species:Homo sapiens


Alignment Length:326 Identity:75/326 - (23%)
Similarity:123/326 - (37%) Gaps:69/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 EFDSISNITLSNALRQLASLVLIASDIFDDLQRDLQAVGERAGRVQRKIAAVERRVCAYDPKTVT 202
            |.:.::|.||:..:|||:||...|.|||.:|..:......||..:|.:|..:..:|...|.   |
Human    25 ELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDS---T 86

  Fly   203 VPESDLLTFAQRKHHFETDKSFQQELFTGETRPLSVRQLYTEAGKELPVATGATATALASLAHSQ 267
            |.|..|.....:| .|::.....|::.:..:.|..|..:|.::.|..|:               .
Human    87 VEEVSLQDINMKK-AFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPL---------------N 135

  Fly   268 SLIPSRSISFNGEVLSSD---------HEVLQLNGSTDTEDHLLCVSDFGNANRKLRTRIDA--- 320
            .|.|.|....:|....:|         .::||     ||||     .......:|.:.|||.   
Human   136 ILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQ-----DTED-----KRKEKRRQKEQKRIDGTTR 190

  Fly   321 EIEIRLPAAIEDLRKWTSSEALGDVTVTPDCMHHVDTSVSTSLAIGENGILTPALSPSVLS--AD 383
            |:: ::..|....::|.....  |..:.|      |..:|.|:..|.:.  ..:|||...|  :|
Human   191 EVK-KVRKARNRRQEWNMMAY--DKELRP------DNRLSQSVYHGASS--EGSLSPDTRSHASD 244

  Fly   384 AVDALYAQNLSQAADSSRHNHHTQALIPNDINKDVP--------LNHRLPSPEEQTKQIALKYPA 440
            ..|..|..       :..|:.|.|.:.|:....|||        ..|....|....:.:||..|.
Human   245 VTDYSYPA-------TPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQ 302

  Fly   441 E 441
            :
Human   303 Q 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gukhNP_732393.1 NHS <818..>846 CDD:291922
WASF3NP_006637.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..210 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..443 21/90 (23%)
WH2_WAVE-3 437..502 CDD:409216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12902
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.