DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gukh and wasf1

DIOPT Version :9

Sequence 1:NP_732393.1 Gene:gukh / 53563 FlyBaseID:FBgn0026239 Length:1788 Species:Drosophila melanogaster
Sequence 2:XP_001335802.7 Gene:wasf1 / 100001221 ZFINID:ZDB-GENE-070705-555 Length:540 Species:Danio rerio


Alignment Length:352 Identity:76/352 - (21%)
Similarity:133/352 - (37%) Gaps:99/352 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 HEFDSISNITLSNALRQLASLVLIASDIFDDLQRDLQAVGERAGRVQRKIAAVERRVCAYDPKTV 201
            :|.:.::||:|:|.:|||:||...|.|:|.:|..:..:...|...:|.::..:...|...|||. 
Zfish    24 NELECVTNISLANVIRQLSSLSKYAEDLFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKE- 87

  Fly   202 TVPESDLLTFAQRKHHFETDKSFQQELFTGETRPLSVRQLYTEAGKELPVATGATATALASLAHS 266
              .|..|.....|| .|.:.....|:||..::.|:.:::.|....:..|:               
Zfish    88 --EELSLQDITMRK-AFRSSTIQDQQLFERQSLPVPMQETYELCEQPPPL--------------- 134

  Fly   267 QSLIPSRSISFNGEVLSSD---------HEVLQLNGSTDTEDHLLCVSDFGNANRKLRTR----- 317
            ..|.|.|.....|....::         .::||     ||||           .||.|.:     
Zfish   135 NILTPYRDDGKEGLKFYTNPSYFFDLWREKMLQ-----DTED-----------KRKERRKQKLQD 183

  Fly   318 ----------IDAEIEI----------RLPAAIEDLRK-W----TSSEALGDVTVTPDCMHHVDT 357
                      :|..:::          ::|.|..|.:| |    ..:|..||   .|:..|. |.
Zfish   184 PHMYDQVYKYLDLPVQLKNIDRPQDADKVPRAPHDRKKEWQKMALGAELAGD---EPENTHR-DA 244

  Fly   358 SVSTSLAIGENGILTPALSPSVLSADAVDALYAQNLSQAADSSRHNHHTQALIPNDINKDVPLNH 422
            :.|.:........:.....|..|:|    ..|:| :::..:.|...::.:   |::         
Zfish   245 NGSAAHTDNRQMYIDHLDGPFSLAA----LPYSQ-MNELLNRSGERNYGR---PHE--------- 292

  Fly   423 RLPSPEEQTKQIALKYPAEVISVNTSG 449
              |.|...:.|..|| ||.||| ::||
Zfish   293 --PPPPPPSHQPDLK-PASVIS-SSSG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gukhNP_732393.1 NHS <818..>846 CDD:291922
wasf1XP_001335802.7 WH2 475..502 CDD:308040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12902
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.