DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and Cdca4

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_001346163.1 Gene:Cdca4 / 71963 MGIID:1919213 Length:237 Species:Mus musculus


Alignment Length:233 Identity:54/233 - (23%)
Similarity:89/233 - (38%) Gaps:58/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 YKDTRLKIRNLSMFKLSRFRQVSEQSLYRSVLICNTLKRIDREIEAEAKELHQAAQQHHQQAAAA 500
            |...|..:.::|:.||.....:.|.:|.|||||.||:::|..|:..:. ..|..|.|:..:|...
Mouse    26 YSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMSQDG-VWHGMAPQNVDRAPVE 89

  Fly   501 AAAAAAAAAQ----AAQYHPAYQQQQQQQQSPPAPLHPHTQQQMDYAPVLNCA--------RLAN 553
            ...:.....:    |.:.|||.:.:.       |||    |..:...|::..|        .|..
Mouse    90 RLVSTEILCRTVRGAEEEHPAPELED-------APL----QNSVSELPIVGSAPGQRNPQSSLWE 143

  Fly   554 MDHYQQL--SFQPQHQQQQQPSQPHSYHERLDSQPAYRGAAAGAGSFATQPSNCDTS-------- 608
            ||..|:.  |||....|         ..|.|:::        .:.|.....|:.|:|        
Mouse   144 MDSPQENRGSFQKSLDQ---------IFETLENK--------NSSSVEELFSDVDSSYYDLDTVL 191

  Fly   609 ----AGASSSNTSGNSNNSSAT---AASSNSSLHPYDH 639
                :|..||..:|....::||   :::..|.|...||
Mouse   192 TGMMSGTKSSLCNGLEGFAAATPPPSSTCKSDLAELDH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648 14/36 (39%)
Cdca4NP_001346163.1 SERTA 33..68 CDD:310547 13/34 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.