DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and Sertad2

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_001349796.1 Gene:Sertad2 / 58172 MGIID:1931026 Length:315 Species:Mus musculus


Alignment Length:382 Identity:87/382 - (22%)
Similarity:121/382 - (31%) Gaps:133/382 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 DGRPGGWCS----ANRSCYKDTRLKIRNLSMFKLSRFRQVSEQSLYRSVLICNTLKRIDREIEAE 482
            ||..|...|    .:|..|...|..|.|:|:.||...|.::|.||.::|||.|.|:||..|::  
Mouse    21 DGLEGKIVSPSDGPSRVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELK-- 83

  Fly   483 AKELHQAAQQHHQQAAAAAAAAAAAAAQAAQYHPAYQQQQQ---------QQQSPPAPLHPHTQQ 538
                                       |.....||:....|         |:..|||   ||...
Mouse    84 ---------------------------QEGSLRPAFTPSSQPSNSLSDSYQEAPPPA---PHPCD 118

  Fly   539 QMDYAPVLNCARLA------NMDHYQQLSFQPQHQQQQQPSQPHSYHERLDSQPAYRGAAAGAGS 597
            .....|:..|...|      |.|.:..|       |...|:.|    .||.|             
Mouse   119 LGSTTPLEACLTPASLLEDDNDDTFCTL-------QAVHPAAP----TRLSS------------- 159

  Fly   598 FATQPSNCDTSAGASSSNTSGNSNNSSATAASSNSSLHPYDHYPFRESQSGRATPFPACPTTTAA 662
             |..|:..|                      |.:|:|...:.               .|||:|:.
Mouse   160 -AALPAEKD----------------------SFSSALDEIEE---------------LCPTSTST 186

  Fly   663 AAAASAAAAASSGGAATTLSSNISSSPASSSTSSNTTSSTVISSSSGN---TVSSNGTTPVAPTA 724
            .||.:||.....|     .||..|...........|..|..:.|..||   |.|:...|.:.   
Mouse   187 EAAHTAAPEGPKG-----TSSESSVQKPEGPEEGRTDDSRFMDSLPGNFEITTSTGFLTDLT--- 243

  Fly   725 SSSNCDTSDSGYADDDSTRSINWSSVLSLS-SQSALDPLNNNDLFSIL-PSAATPTA 779
                  ..|..:||.| |...::....|.| :.|.:.|::.:||...| |.:..|.|
Mouse   244 ------LDDILFADID-TSMYDFDPCTSASGTASKMAPVSADDLLKTLAPYSNQPVA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648 17/36 (47%)
Sertad2NP_001349796.1 SERTA 46..81 CDD:310547 16/34 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.