DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and sertad2a

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_001373568.1 Gene:sertad2a / 571662 ZFINID:ZDB-GENE-050309-236 Length:222 Species:Danio rerio


Alignment Length:247 Identity:60/247 - (24%)
Similarity:90/247 - (36%) Gaps:84/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 VSSNGTTPVAPTASSSNCDTSDSGYADDDSTRSINWSSVLSLS----------SQSALD--PLNN 764
            ||:||          |:.|.|:|   :..|...:...:||:||          |:..|.  .|.:
Zfish    18 VSNNG----------SSLDESES---ESSSGYRLQRQTVLNLSLLKLHSVPGHSEPRLSRRVLIS 69

  Fly   765 NDLFSILPSAATPTAVPVSVPASSSSSSSGSTLA----------FSGSFTTVQASGGSSSSCGSS 819
            |.|..|...........|.:..|.:..:..|.||          .:..|:|...| .||.|..|.
Zfish    70 NTLRHIRDELRVEGGASVRLQPSITKDAFSSALADIEDLCPTVGITALFSTADVS-SSSESVHSD 133

  Fly   820 STTATFTTLS-----TISSATHSL---TSSYVSSISSNVSAGANTWEYGFLDMEFGLGSEFTELV 876
            .:.:..:.||     ::|.:||.:   |||.::..|.:          .||         |||: 
Zfish   134 ESRSVDSDLSEMRSKSLSDSTHPVLGHTSSLIADFSLD----------DFL---------FTEI- 178

  Fly   877 PSCKLSSEDLF----KSGLGGQVVTASRLHDN--------ELEHPAHIMVGS 916
                    |.|    |:|.||..:..|.|..|        ||:|...::|||
Zfish   179 --------DNFLLDSKTGFGGAGIGQSALQTNQTFKLDLSELDHIMEVLVGS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648
sertad2aNP_001373568.1 SERTA 43..78 CDD:399196 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.