DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and si:dkey-177p2.6

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_001068584.1 Gene:si:dkey-177p2.6 / 568712 ZFINID:ZDB-GENE-030131-5926 Length:285 Species:Danio rerio


Alignment Length:280 Identity:58/280 - (20%)
Similarity:94/280 - (33%) Gaps:82/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 PVVPFAGLPLHGLPLKRCCD--GRPGGWCSAN-----------RSC--------YKDTRLKIRNL 446
            |.|....|.:....:|:..:  ||.|...|:.           .:|        |...|..:.:|
Zfish    20 PTVSMCRLDVESAVVKKEVEPGGRDGALSSSRYLLGRGVKRKLSTCEDPAQDLPYPQQRQLVLDL 84

  Fly   447 SMFKLSRFRQVSEQSLYRSVLICNTLKRIDREIEAEAKELHQAAQQHHQQAAAAAAAAAAAAAQA 511
            .:.||...::.:|.||:||||:.|||::|.:|:..|.:                   .....|..
Zfish    85 CLDKLQSCQRRAEPSLHRSVLLANTLRQIQQEMRQEGE-------------------TCLPPAVL 130

  Fly   512 AQYHPAYQQQQQQQQSPPAPLH---PHTQQQMDYAPVLNCARLANMDHYQQLSFQPQHQQQQQPS 573
            ....|..|..:...:.||.||.   |.|.......|::....       :::.......:...||
Zfish   131 GPSLPHIQTPRHVPELPPVPLDCPAPLTGALSPSFPLMTADE-------EEIQLGGTENETLLPS 188

  Fly   574 QPHSYHERLDSQPAYRGAAAGAGSFATQPS--------------NCDTSAGASS--------SNT 616
                    |..:...:.:....|||....|              :.|||...||        :..
Zfish   189 --------LAGEDNTKSSDLLFGSFEITNSTSYLTDLPLDDIFEDIDTSMYDSSDISVLAVPAQR 245

  Fly   617 SGNSNN--SSATAASSNSSL 634
            ||..::  .|.::.||||||
Zfish   246 SGGVDDGLKSLSSCSSNSSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648 15/36 (42%)
si:dkey-177p2.6NP_001068584.1 SERTA 81..118 CDD:283648 15/36 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.