DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and sertad3

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:NP_001014343.2 Gene:sertad3 / 541508 ZFINID:ZDB-GENE-050327-34 Length:244 Species:Danio rerio


Alignment Length:73 Identity:24/73 - (32%)
Similarity:36/73 - (49%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 GLPLKRCCDGRPGGWCSANRSCYKDTRLKIRNLSMFKLSRFRQVSEQSLYRSVLICNTLKRIDRE 478
            |...|.|.|....|      |.::.....:.::||.|..|.:.:.|.||.|||||.|||:::..|
Zfish     5 GQKRKLCRDDEGAG------SAWESQLQSVLDISMDKYQRDQALVEPSLLRSVLINNTLRQVQSE 63

  Fly   479 IEAEAKEL 486
            :.|:...|
Zfish    64 VRAQVDSL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648 16/36 (44%)
sertad3NP_001014343.2 SERTA 28..63 CDD:310547 15/34 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.