powered by:
Protein Alignment tara and sertad3
DIOPT Version :9
Sequence 1: | NP_524994.2 |
Gene: | tara / 53562 |
FlyBaseID: | FBgn0040071 |
Length: | 916 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001014343.2 |
Gene: | sertad3 / 541508 |
ZFINID: | ZDB-GENE-050327-34 |
Length: | 244 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 36/73 - (49%) |
Gaps: | 6/73 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 414 GLPLKRCCDGRPGGWCSANRSCYKDTRLKIRNLSMFKLSRFRQVSEQSLYRSVLICNTLKRIDRE 478
|...|.|.|....| |.::.....:.::||.|..|.:.:.|.||.|||||.|||:::..|
Zfish 5 GQKRKLCRDDEGAG------SAWESQLQSVLDISMDKYQRDQALVEPSLLRSVLINNTLRQVQSE 63
Fly 479 IEAEAKEL 486
:.|:...|
Zfish 64 VRAQVDSL 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tara | NP_524994.2 |
SERTA |
443..480 |
CDD:283648 |
16/36 (44%) |
sertad3 | NP_001014343.2 |
SERTA |
28..63 |
CDD:310547 |
15/34 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR16277 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.