DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and Cdca4

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:XP_038968691.1 Gene:Cdca4 / 500727 RGDID:1563593 Length:243 Species:Rattus norvegicus


Alignment Length:249 Identity:50/249 - (20%)
Similarity:89/249 - (35%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 KRCCDGRPGGWCSANRSCYKDTRLKIRNLSMFKLSRFRQVSEQSLYRSVLICNTLKRIDREIEAE 482
            ::|.|...|.........|...|..:.::|:.||.....:.|.:|.|||||.||:::|..|:..:
  Rat    14 RKCGDQEEGVEGFGTVPSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMSQD 78

  Fly   483 AKELHQAAQQHHQQAAAAAAAAAAAAAQAAQ----YHPAYQQQQQQQQSPPAPLHPHTQQQMDYA 543
            . ..|..|.|..::|......:.....:..:    .||..:.:....||..:.|           
  Rat    79 G-VWHGMAPQSVERAPIDRLVSTEILCRTVRGSEGEHPTSELEDSPLQSSASEL----------- 131

  Fly   544 PVLNCAR--------LANMDHYQQLSFQPQHQQQQQPSQPHSYHERLDSQPAYRGAAAGAGSFAT 600
            |::..|:        |..||:       ||..:...........|.|:::        .:.|...
  Rat   132 PIVGSAQGQRNPQSSLWEMDN-------PQENRGSLQKSLDQIFETLENK--------NSSSVEE 181

  Fly   601 QPSNCDTS------------AGASSSNTSGNSNNSSAT---AASSNSSLHPYDH 639
            ..|:.|:|            .|..||..:|..:.::|.   :::..|.|...||
  Rat   182 LFSDVDSSYYDLDTVLTGMMTGTKSSLCNGLESFTAAAPPPSSTCKSDLAELDH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648 14/36 (39%)
Cdca4XP_038968691.1 SERTA 39..74 CDD:399196 13/34 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16277
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.