powered by:
Protein Alignment tara and cdca4
DIOPT Version :9
Sequence 1: | NP_524994.2 |
Gene: | tara / 53562 |
FlyBaseID: | FBgn0040071 |
Length: | 916 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005160620.1 |
Gene: | cdca4 / 494037 |
ZFINID: | ZDB-GENE-030131-1695 |
Length: | 312 |
Species: | Danio rerio |
Alignment Length: | 46 |
Identity: | 17/46 - (36%) |
Similarity: | 27/46 - (58%) |
Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 434 SCYKDTRLKIRNLSMFKLSRFRQVSEQSLYRSVLICNTLKRIDREI 479
|.|...|..:.::|:.||.....:.|.:|.|||||.||:::|..|:
Zfish 55 SSYSLQRQSLLDMSLIKLQLCHMLVEPNLCRSVLIANTVRQIQEEM 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tara | NP_524994.2 |
SERTA |
443..480 |
CDD:283648 |
14/37 (38%) |
cdca4 | XP_005160620.1 |
SERTA |
64..100 |
CDD:283648 |
13/35 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170586497 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR16277 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.