DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and sertad2

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:XP_031757881.1 Gene:sertad2 / 100491459 XenbaseID:XB-GENE-5772329 Length:411 Species:Xenopus tropicalis


Alignment Length:377 Identity:87/377 - (23%)
Similarity:129/377 - (34%) Gaps:117/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 DGRPGGWCS----ANRSCYKDTRLKIRNLSMFKLSRFRQVSEQSLYRSVLICNTLKRIDREIEAE 482
            ||..|...|    .::..|...|..|.|:|:.||...|.::|.||.::|||.|.|:||       
 Frog   111 DGMEGKVVSPTDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRI------- 168

  Fly   483 AKELHQAAQQHHQQAAAAAAAAAAAAAQAAQYHPAYQQQQQQQQSPPAPLHPHTQQQMDYAPVLN 547
                                                 |::.:|:....|:...|.|..|  |:  
 Frog   169 -------------------------------------QEEMKQEGSLRPVFISTSQSSD--PL-- 192

  Fly   548 CARLANMDHYQQLSFQPQHQQ-QQQPSQPHSYHERLDSQPAYRGAAAGAGSFATQP-SNCDTSAG 610
                  .|.||:.  ||.... ...|.||:..                   .:|.| .:|.|.|.
 Frog   193 ------GDAYQEA--QPAFSHLAPSPVQPNDL-------------------LSTTPLESCLTPAS 230

  Fly   611 ASSSNTSGNSNNSSATAASSN-SSLHPYDHYPFRESQSGRATPF-PACPTTTAAAAAASAAAAAS 673
            ....:|...|..:.....||. ....|....|.::|.|...... ..|||:|:..|||:..|.| 
 Frog   231 LLEDDTFCTSQTTQQNGPSSKLPPPPPPPIQPVKDSFSSALDEIEELCPTSTSTEAAATEEATA- 294

  Fly   674 SGGAATTLSSNISSSPASSST-------SSNTTSSTVISSSSGN---TVSSNGTTPVA-PTASSS 727
                      :::...|:|||       .|.|:...::.|..||   |.|:...|.:. .....|
 Frog   295 ----------HVNDDTAASSTHKPEGTQESRTSEPKLMDSLPGNFELTTSTGFLTDLTLDDILFS 349

  Fly   728 NCDTSDSGYADDDSTRSINWSSVLSLSSQSALDPLNNNDLFSILPSAATPTA 779
            :.||  |.|..|..|      |....:|:.|.|.|    |.::.|.::.|.|
 Frog   350 DIDT--SMYDFDPCT------SNAGTASKMAPDEL----LKTLSPYSSQPVA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648 16/36 (44%)
sertad2XP_031757881.1 SERTA 136..171 CDD:399196 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.