DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tara and sertad1

DIOPT Version :9

Sequence 1:NP_524994.2 Gene:tara / 53562 FlyBaseID:FBgn0040071 Length:916 Species:Drosophila melanogaster
Sequence 2:XP_002938850.2 Gene:sertad1 / 100486906 XenbaseID:XB-GENE-5756075 Length:263 Species:Xenopus tropicalis


Alignment Length:230 Identity:50/230 - (21%)
Similarity:84/230 - (36%) Gaps:75/230 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KRKHELTFDSKDANTTYTGNCAPPPVKANKWAISNNNYLESLEEQQQQQQSP-SEPAVESNNNHI 85
            ||||....:...:|        |.||            ||.        :.| |.||::|   |.
 Frog     7 KRKHSEVDEGMGSN--------PDPV------------LEG--------ECPCSFPAIQS---HC 40

  Fly    86 VLEASM----DALKPTEPSISNGHEVTTAVAAMKSQAEVPLPPTA---------------SAAIP 131
            ::..|:    .:|...||.:.  |.|..|....:.|..:.:.|.|               .||.|
 Frog    41 LMNISLVKLHRSLHHVEPDLR--HLVLVANTLRRLQGNLQVEPCAPGTWKISEECRKECSPAAGP 103

  Fly   132 EDSIARLE----VVTSAVPCEPWTS-----------NGPTTPSAVAGPAASAEPVD-CISKLQAV 180
            |:....||    .:.|::....::|           :|.::|     |....|... |..|:..|
 Frog   104 ENKKPALENTEDPLLSSMDASLYSSISTILEDLNNFDGLSSP-----PLPQVEDDQLCAPKVNPV 163

  Fly   181 AVPSDPWGSIATRSTLATT-LLSADELDDDDDDFE 214
            :|.::....:|:.|.|::: .|..|.|:|..:|.:
 Frog   164 SVSTEDMMKLASSSFLSSSPYLLGDNLEDIFEDID 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taraNP_524994.2 SERTA 443..480 CDD:283648
sertad1XP_002938850.2 SERTA 41..74 CDD:399196 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.