DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmet and Klp54D

DIOPT Version :9

Sequence 1:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster
Sequence 2:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster


Alignment Length:693 Identity:181/693 - (26%)
Similarity:302/693 - (43%) Gaps:170/693 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SIQVCIKVRPCE--------------PG----LTSLWQVKERRSIHLADSHAEPYVFDYVFDEGA 54
            :|.|.::|||..              ||    :.....|.::|| |..|| ...:.::.||:.||
  Fly   166 NINVVVRVRPLNDKEKRDRHGSTLQFPGNGQVILEGNDVGQKRS-HNRDS-VRVFTYNVVFEPGA 228

  Fly    55 SNQEVFDRMA-KHIVHACMQGFNGTIFAYGQTSSGKTYTMMG------DEQNP-----GVMVLAA 107
            :.:::.|... |.|:...::||:.|.|.||||.||||:|:.|      .:.||     |::..:.
  Fly   229 TQEDILDYSGIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPNPKDPRHGLIFRSF 293

  Fly   108 KEIFQQISSETERDFLLRVGYIEIYNEKIYDLLN----KKNQDLKIHESGNG-----IVNVNCEE 163
            ..:||.|.:..:.:::|:..::|||||::.||||    :|...::..:...|     :..|:|||
  Fly   294 LYLFQLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSKKSGGFFVENLFTVDCEE 358

  Fly   164 CIITSEVDLLRLLCLGNKERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQS---VLNL 225
            .     .|||.:|..|.:.|.||...||:.|||||.|..:.|   .||...|..|..|   .:|.
  Fly   359 L-----DDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHI---LSDQQTDGGVFLSKHGKINF 415

  Fly   226 VDLAGSERADQTGARGARLKEGGHINKSLLFLSNVIKSLSENADNR-FTNYRDSKLTRILQASLG 289
            |||||||...:|.:.|..|:|..:|||||:.|...|.|||::.... ...||||:||::|..||.
  Fly   416 VDLAGSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLSDSKKRTGHIPYRDSQLTKLLADSLA 480

  Fly   290 GNAFTSIICTIKPSIME--ESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLA 352
            ||..|.:|..:.|:...  |:.:||.:|:|||:||.||.:.....:|.::. |:|:|..|     
  Fly   481 GNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVIKMDPREALILS-LKRDIHAL----- 539

  Fly   353 EEERKNENQQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRI 417
                    |.:.:||:..:  ::|     |..:..|                      |..|:.:
  Fly   540 --------QMENDHLKAAL--NLH-----HQAAPNG----------------------GPVENLL 567

  Fly   418 D-QFPKVSHLPKPVFFHTSNAGKRWDNIPKT-INILGSLDIGTESNS------ISEEFLPAECID 474
            : |..:||          |..|.   .:||. :..|..|| |:|...      :..|.|..|...
  Fly   568 ELQLDRVS----------SGGGV---PVPKVDLQRLPELD-GSELAELVKLYMVENESLRQENNH 618

  Fly   475 FGSPRPDVLKPM--------LTIRQLPDL-------PLTPKGPLTTDKIKKEIQDLQMFTSLEKH 524
            ..:.|..:|:..        ..:::|.|:       ||.|..|..:....||....:::|:.|  
  Fly   619 LFTVRETILRDQEIVCRENERLLKKLEDVNKVCVRSPLIPARPAISPTTGKETPGTEIWTNPE-- 681

  Fly   525 FEVECEEVQG----LKEKLAEVTAQRDNLEQESLAEKERYDALEKEVTSLRADNEAANSKISELE 585
               ..:...|    ::::::|...:|.:..|:.:.:|.    :.|.:..:.   .|.....|::.
  Fly   682 ---PLQSPPGPDLPIEQRMSENANRRTDTAQKRIDQKR----IAKNILIMA---NAFRKPDSDIT 736

  Fly   586 EKLSTLKQTMRIMEVENQVAVGLEFEFEAHKKSSKLRVDDLLS 628
            ::|:...:                   |||.|.|...:.|:|:
  Fly   737 KELNLNPE-------------------EAHAKQSTEFMPDMLT 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmetNP_524993.3 KISc 8..328 CDD:214526 125/364 (34%)
Motor_domain 8..321 CDD:277568 121/357 (34%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 125/363 (34%)
KISc 166..512 CDD:276812 119/355 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.