DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmet and sub

DIOPT Version :9

Sequence 1:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster


Alignment Length:612 Identity:152/612 - (24%)
Similarity:241/612 - (39%) Gaps:201/612 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAKNASSI----QVCIKVRPCEPG-------------LTSLWQVKERRSIHLADSHAEPYVFDYV 49
            ||.::|::    ||.:::||.:..             :||........:::..:.|   :.|..:
  Fly    77 SAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKH---FGFTSI 138

  Fly    50 FDEGASNQEVFDRMA--KHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQ 112
            ||.....::::|...  |.:...|:     ||..||.:.||||||::||:...|::..|.:.||.
  Fly   139 FDSTVGQRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFT 198

  Fly   113 -------------------------------------------------------------QISS 116
                                                                         :..:
  Fly   199 IYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKA 263

  Fly   117 ETERDFLLRVGYIEIYNEKIYDLL------------NKKNQDLKI-----HESGNGIVNVNCEEC 164
            .|:...|:.|.::|||||.:||||            .:||  |||     |....|:.:|     
  Fly   264 STDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKN--LKIVGNKGHVFIKGLTSV----- 321

  Fly   165 IITSEVDLLRLLCLGNKERTVGETNMNERSSRSHAIFKI-IIESRKSDHSDDDAVIQSVLNLVDL 228
            .:||..:.||||.||.:..|...|::|..|||||.:|.: |::..:|     ....||.....||
  Fly   322 FVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRS-----GITTQSSYKFCDL 381

  Fly   229 AGSERADQTGARGARLKEGGHINKSLLFLSNVIKSLS-----ENADNRFTNYRDSKLTRILQASL 288
            |||||.:.||..|.||||..:||.||:.|...:.:.|     :|||  ...|||||||.:|||:|
  Fly   382 AGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNAD--IIPYRDSKLTMLLQAAL 444

  Fly   289 GGNAFTSIICTIKP--SIMEESQSTLSFATRAKKIRIKPQV--NEMVSDATMMK----------- 338
            .|....::|.|:.|  ...||:.:.|:||:.||.|..|..|  ...||....|:           
  Fly   445 LGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGD 509

  Fly   339 ----------RLEREIK------VLKDKLAEEERKNE----NQQKVEHLERQIKHDMH-KIICGH 382
                      ||:.||:      ||:.:|.||:.:.|    .|:.:::.::|.:.:.. |::...
  Fly   510 YTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQ 574

  Fly   383 SLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQFPKVSHLPKPVFFHTSNAGKRWDNIPKT 447
            ..|:.....:||.:                 |::|:...                    |.|.:.
  Fly   575 RESEFMLSSQRRRY-----------------EEQIEDLK--------------------DEIEEL 602

  Fly   448 INILGSLDIGTESNSISEEFLPAECID 474
            .|.....||..:.|   |...|.|.:|
  Fly   603 KNPASDTDISDDPN---ESKSPIEILD 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmetNP_524993.3 KISc 8..328 CDD:214526 118/426 (28%)
Motor_domain 8..321 CDD:277568 115/417 (28%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
subNP_001286548.1 KISc 89..477 CDD:276812 113/409 (28%)
Kinesin 93..479 CDD:278646 113/407 (28%)
GBP_C <512..603 CDD:303769 20/127 (16%)
coiled coil 576..586 CDD:293879 1/9 (11%)
coiled coil 592..603 CDD:293879 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.