DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmet and KIF22

DIOPT Version :9

Sequence 1:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster
Sequence 2:XP_024306038.1 Gene:KIF22 / 3835 HGNCID:6391 Length:723 Species:Homo sapiens


Alignment Length:711 Identity:187/711 - (26%)
Similarity:301/711 - (42%) Gaps:186/711 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IQVCIKVR------------PCEPGLTSLWQVKERRSIHLAD--SHAE--PYVFDYVFDEGASNQ 57
            ::|.:::|            ||..|:.|.       |:.:|:  :|.|  .|.||..:.|.::.|
Human    44 VRVAVRLRPFVDGTAGASDPPCVRGMDSC-------SLEIANWRNHQETLKYQFDAFYGERSTQQ 101

  Fly    58 EVFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSE--TER 120
            :::....:.|:...::|.|.::.|||.|.:|||:||:|..:.|||:..|..::.|....|  ..|
Human   102 DIYAGSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGR 166

  Fly   121 DFLLRV--GYIEIYNEKIYDLLNKKNQDLKIHESGNG-IVNVNCEECIITSEVDLLRLLCLGNKE 182
            .:.|.|  .|:|||.||:.|||:..:.||.|.|...| |:.....:..|:|..|..|.....::.
Human   167 PWALSVTMSYLEIYQEKVLDLLDPASGDLVIREDCRGNILIPGLSQKPISSFADFERHFLPASRN 231

  Fly   183 RTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGARGARLKEG 247
            ||||.|.:|:|||||||:..:.::.|  :........:..|.|:||||||...:||.:|.||||.
Human   232 RTVGATRLNQRSSRSHAVLLVKVDQR--ERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKES 294

  Fly   248 GHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKPS--IMEESQS 310
            |.||.||..|..|:.:|::....  ..||||||||:||.||||:|.:.:|..|.|.  ...::.|
Human   295 GAINTSLFVLGKVVDALNQGLPR--VPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYLDTVS 357

  Fly   311 TLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNENQQKVEHLERQIKHDM 375
            .|:||.|:|::..:|..||.:....:.          ..||:::|                    
Human   358 ALNFAARSKEVINRPFTNESLQPHALG----------PVKLSQKE-------------------- 392

  Fly   376 HKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQFPKVSHLPKPVFFHTSNAGKR 440
                    |....:.||.|                |..|:.|..       |:|:....| |.::
Human   393 --------LLGPPEAKRAR----------------GPEEEEIGS-------PEPMAAPAS-ASQK 425

  Fly   441 WDNIPKTINILGSLDIGTESNSISEEFLPAECIDFGSPRPDVLKPMLTIRQLPDLPLTPKGP--- 502
            ...:.|    |.|:|                        |.:|:.:|::.:|    |..:|.   
Human   426 LSPLQK----LSSMD------------------------PAMLERLLSLDRL----LASQGSQGA 458

  Fly   503 --LTTDKIKKEIQDLQMFTSLEKHFEVECEEVQGLKEKLAEVTAQRDNLEQESLAEKERYDALEK 565
              |:|.|.::.:   .|.|..||..|:|     .||.|..|       ||.:.||:|    |.||
Human   459 PLLSTPKRERMV---LMKTVEEKDLEIE-----RLKTKQKE-------LEAKMLAQK----AEEK 504

  Fly   566 E--------------VTSLRADNEAANSKISELEEKLST-------LKQTMRIMEVENQVAVGLE 609
            |              ||..:...:|....:..::|:.::       ||...|..::|:..|:   
Human   505 ENHCPTMLRPLSHRTVTGAKPLKKAVVMPLQLIQEQAASPNAEIHILKNKGRKRKLESLDAL--- 566

  Fly   610 FEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTRDVLRNSKEGHMLSIAPEQEDI 670
               |..:|:     :|.....:..|......||.||.|.....|:.:.  :..|.|::..:
Human   567 ---EPEEKA-----EDCWELQISPELLAHGRQKILDLLNEGSARDLRS--LQRIGPKKAQL 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmetNP_524993.3 KISc 8..328 CDD:214526 118/341 (35%)
Motor_domain 8..321 CDD:277568 117/334 (35%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
KIF22XP_024306038.1 KISc_KID_like 43..366 CDD:276827 116/332 (35%)
ComEA <596..632 CDD:333350 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.