DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmet and Klp59C

DIOPT Version :9

Sequence 1:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster
Sequence 2:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster


Alignment Length:366 Identity:123/366 - (33%)
Similarity:192/366 - (52%) Gaps:47/366 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NASSIQVCIKVRPCE--------------PGLTSLWQVKERRSIHLA---DSHAEPYVFDYVFDE 52
            |...|.||::.||..              |...:|...:.|:.::|.   ::|:  :.|||||||
  Fly   184 NCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHS--FRFDYVFDE 246

  Fly    53 GASNQEVFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNP--------GVMVLAAKE 109
            ..||..|::..|:.::.....|...|.||||||.|||||||.|  |.|        |:..:|||:
  Fly   247 ECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGG--QFPGRHQSSMDGIYAMAAKD 309

  Fly   110 IFQQISSETERDFLLRV--GYIEIYNEKIYDLLNKKNQDLKIHESGNGIVN-VNCEECIITSEVD 171
            :|..:.:.......|:|  .:.|||..:::|||......|::.|..|..|. |...:..:.:..:
  Fly   310 VFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAE 374

  Fly   172 LLRLLCLGNKERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSER-AD 235
            :|.||.|||..||.|.|:.|.:||||||:|:|::.|...:.      :....:|:||||:|| ||
  Fly   375 VLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEK------LHGKFSLIDLAGNERGAD 433

  Fly   236 QTGA-RGARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQAS-LGGNAF-TSII 297
            .:.| |..|| ||..||||||.|...|::|...:.:  ..:|.||||::|:.| :||... |.:|
  Fly   434 NSSADRQTRL-EGSEINKSLLVLKECIRALGRQSSH--LPFRGSKLTQVLRDSFIGGKKVKTCMI 495

  Fly   298 CTIKPSI--MEESQSTLSFATRAKKIRIKPQVNEMVSDATM 336
            ..|.|.:  :|.:.:||.:|.|.|::.::...::.:.||.:
  Fly   496 AMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANL 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmetNP_524993.3 KISc 8..328 CDD:214526 120/353 (34%)
Motor_domain 8..321 CDD:277568 120/346 (35%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 119/344 (35%)
Kinesin 193..520 CDD:278646 116/339 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.