DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmet and nod

DIOPT Version :9

Sequence 1:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster
Sequence 2:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster


Alignment Length:569 Identity:148/569 - (26%)
Similarity:242/569 - (42%) Gaps:141/569 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKNASSIQVCIKVRPC-------EPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQE 58
            |.....|::::.::..|.       ||.:.......:.:|: :.|.:  .:.||:.|....|..|
  Fly     1 MEGAKLSAVRIAVREAPYRQFLGRREPSVVQFPPWSDGKSL-IVDQN--EFHFDHAFPATISQDE 62

  Fly    59 VFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTM----MGD--EQNPGVMVLAAKEIFQQISS- 116
            ::..:...:|...::||..|..|||||.:||:|:|    .|:  .::.|::..|..:||::::: 
  Fly    63 MYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTAR 127

  Fly   117 -ETERDFL-LRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECI---ITSEVDLLRLL 176
             |..:|.: :...:|||||||.:|||.....        ..:|...|:.|.   :.|:.||..:|
  Fly   128 QENNKDAIQVYASFIEIYNEKPFDLLGSTPH--------MPMVAARCQRCTCLPLHSQADLHHIL 184

  Fly   177 CLGNKERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGARG 241
            .||.:.|.|..||||..|||||||..|.::| |:.||.        :|:|||||||...:||..|
  Fly   185 ELGTRNRRVRPTNMNSNSSRSHAIVTIHVKS-KTHHSR--------MNIVDLAGSEGVRRTGHEG 240

  Fly   242 ARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKP--SI 304
            ...:||.:||..||.::.|:.|::  |.:....||||.||.:|||||...::.:.:..|.|  ..
  Fly   241 VARQEGVNINLGLLSINKVVMSMA--AGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCD 303

  Fly   305 MEESQSTLSFATRAKKIRIKP-QV--------------------------------NEMV---SD 333
            :.|:.|||.|.|.|||:|:.| ||                                |.:|   |.
  Fly   304 LSETLSTLRFGTSAKKLRLNPMQVARQKQSLAARTTHVFRQALCTSTAIKSNAANHNSIVVPKSK 368

  Fly   334 ATMMKRLEREIKVLKDKLAEEERKNENQQKVEHLER--------QIKHDMHKIICGHSLSDK--- 387
            .:..|.|...:...:.:|....:..:..:::..||.        .|:.....::..||.|||   
  Fly   369 YSTTKPLSAVLHRTRSELGMTPKAKKRARELLELEETTLELSSIHIQDSSLSLLGFHSDSDKDRH 433

  Fly   388 ------GQQKRRRT----------------------------WCPT-----------------AS 401
                  ||:.|:.:                            ..||                 ||
  Fly   434 LMPPPTGQEPRQASSQNSTLMGIVEETEPKESSKVQQSMVAPTVPTTVRCQLFNTTISPISLRAS 498

  Fly   402 GSHLELAETGTTEDRIDQFPKVSHLPKPVFFHTSNAGKRWDNIPKTINI 450
            .|..||:.....|:.:...|:...|.:.|...:|...:.:..|||.:|:
  Fly   499 SSQRELSGIQPMEETVVASPQQPCLRRSVRLASSMRSQNYGAIPKVMNL 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmetNP_524993.3 KISc 8..328 CDD:214526 113/373 (30%)
Motor_domain 8..321 CDD:277568 108/333 (32%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
nodNP_001285129.1 KISc 8..325 CDD:214526 110/338 (33%)
KISc 8..318 CDD:276812 106/331 (32%)
ComEA 540..648 CDD:224472 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.