DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmet and CG32318

DIOPT Version :9

Sequence 1:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:93 Identity:26/93 - (27%)
Similarity:44/93 - (47%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KNASSIQVCIKVRP------CEPGLTSLWQVKERRSI--HLADSH-AEPYVFDYVFDEGASNQEV 59
            |:..:|||.::|||      |......:..|..|..:  |..||. .:.:.||..|...:...:|
  Fly    15 KSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDV 79

  Fly    60 FDRMAKHIVHACMQGFNGTIFAYGQTSS 87
            :..:...::...:.|:|.|:||||||.:
  Fly    80 YSVVVSPLIEEVLNGYNCTVFAYGQTGN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmetNP_524993.3 KISc 8..328 CDD:214526 25/89 (28%)
Motor_domain 8..321 CDD:277568 25/89 (28%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.