DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and Sox12

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:245 Identity:55/245 - (22%)
Similarity:98/245 - (40%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1218 GAAGTAAGQPA-----NKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQ 1277
            |.|...|.:|.     :..|:|||||||::|:..|:.:..:.|:..|..:||.||..|..|:..:
  Rat    21 GPAAEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSE 85

  Fly  1278 KAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATP-----GGKAS------------GAAG 1325
            |..:...|..::..|...:|::|:..:.:.|.:.:.|.|     ||..|            |...
  Rat    86 KIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGGGGGSRLKPGPQLPGRGGRRA 150

  Fly  1326 TG---------------DAKQRLVSVDGSDSLEHDMCPSTPGGSGSCG----GQGISSDLQGDII 1371
            ||               |.::.|:.|...::...::....|.|..:.|    .||.||:      
  Rat   151 TGGPLGGGAAAPEDDDEDEEEELLEVRLLETPGRELWRMVPAGRAARGPAERAQGPSSE------ 209

  Fly  1372 PLTIDNYNSTCDEAPTTISMKGNGNGKLMKNELPSDEDEQMLVVEEEQQQ 1421
                   .:....|..|:|          ::|.|.:|:|:....||.:::
  Rat   210 -------GAAASAASPTLS----------EDEEPEEEEEEAATAEEGEEE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 23/70 (33%)
Sox12NP_001162121.1 SOX-TCF_HMG-box 39..110 CDD:238684 23/70 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.