DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and SOX12

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens


Alignment Length:353 Identity:70/353 - (19%)
Similarity:119/353 - (33%) Gaps:124/353 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1186 DGAAGAPATSAAKRRSQSLSALQQQQQQQQQAGAAGTAAGQPANKKIRRPMNAFMIFSKKHRKMV 1250
            ||....|....|             ::..::.|...|.:|.     |:|||||||::|:..|:.:
Human    12 DGGPPPPGPGPA-------------EEGAREPGWCKTPSGH-----IKRPMNAFMVWSQHERRKI 58

  Fly  1251 HKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTAT 1315
            ..:.|:..|..:||.||..|..|:..:|..:...|..::..|...:|::|:             .
Human    59 MDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKY-------------R 110

  Fly  1316 PGGKASGAAGTGDAKQRLVSVDGSDSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNS 1380
            |..|:.||    .||.|               |..|||||  ||..:....|             
Human   111 PRKKSKGA----PAKAR---------------PRPPGGSG--GGSRLKPGPQ------------- 141

  Fly  1381 TCDEAPTTISMKGNGNGKLMKNEL------PSDEDEQMLVVEEEQQQQTVKKIDLHCRE------ 1433
                      :.|.|..:.....|      |.|:||     :::::...|:.::...||      
Human   142 ----------LPGRGGRRAAGGPLGGGAAAPEDDDE-----DDDEELLEVRLVETPGRELWRMVP 191

  Fly  1434 ------------------------RVNDSDMDDTPFDYRKQQPEANQRSAEEHSTSGAN--GQAI 1472
                                    ..:.:..:|...:..:::..|.:...||...||..  |...
Human   192 AGRAARGQAERAQGPSGEGAAAAAAASPTPSEDEEPEEEEEEAAAAEEGEEETVASGEESLGFLS 256

  Fly  1473 NAPPLSGG------EREITLKPKAIKAH 1494
            ..||...|      :|:..|:|.:..:|
Human   257 RLPPGPAGLDCSALDRDPDLQPPSGTSH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 23/70 (33%)
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 7/45 (16%)
SOX-TCF_HMG-box 39..110 CDD:238684 23/88 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 43/247 (17%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.