DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and SOX4

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_003098.1 Gene:SOX4 / 6659 HGNCID:11200 Length:474 Species:Homo sapiens


Alignment Length:486 Identity:106/486 - (21%)
Similarity:163/486 - (33%) Gaps:157/486 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1219 AAGTAAGQPA-----NKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQK 1278
            :.|..|..|:     :..|:|||||||::|:..|:.:.::.|:..|..:||.||:.|..||...|
Human    41 STGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDK 105

  Fly  1279 AQYHELASSVKDAHFKLHPEWKWCSKDRRKS----STSTAT----PGGKASGAAGTGDAKQRLVS 1335
            ..:...|..::..|...:|::|:..:.:.||    |:|:|.    ||.|.....|:|........
Human   106 IPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGG 170

  Fly  1336 VDGSDSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNSTCDEA-------------PT 1387
            ..||.:       :..||.|:.||...|...|           ..:|...             ..
Human   171 GGGSSN-------AGGGGGGASGGGANSKPAQ-----------KKSCGSKVAGGAGGGVSKPHAK 217

  Fly  1388 TISMKGNGNGKLMKNELPSDEDEQ-----MLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDY 1447
            .|...|.|.||.......|...||     :|.:.......::                      |
Human   218 LILAGGGGGGKAAAAAAASFAAEQAGAAALLPLGAAADHHSL----------------------Y 260

  Fly  1448 RKQQPEANQRSAEEHSTSGANGQAINAPPLSGGEREITLKPKAIKAHPVLESNMLPYTQMSIYTQ 1512
            :.:.|     ||...::|.|:..|..|.|   |:.   |..|.:|               .:|. 
Human   261 KARTP-----SASASASSAASASAALAAP---GKH---LAEKKVK---------------RVYL- 298

  Fly  1513 YTSPKNPIGVTPFQPTGG-AFKSMPISPKGSGGKPEDAGSLQAHIKQEDIKQEPPSPYKLNNGSG 1576
                           .|| ...|.|:...|:|..|.|...|   .::|.....|.:| .|:..|.
Human   299 ---------------FGGLGTSSSPVGGVGAGADPSDPLGL---YEEEGAGCSPDAP-SLSGRSS 344

  Fly  1577 SASGGGVVSAPPPNSGSVGAIFNFNVPTATALSQKQFHYPMHHPHRSPTDLRAAHQACVPSSPAG 1641
            :||.        |.:|...|                       .||....||||..|  |||.. 
Human   345 AASS--------PAAGRSPA-----------------------DHRGYASLRAASPA--PSSAP- 375

  Fly  1642 MGLGHAANIATPPASAPAQIMGGGPASQKMF 1672
               .||::.|:..:|:.:.  .|..:|...|
Human   376 ---SHASSSASSHSSSSSS--SGSSSSDDEF 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 24/70 (34%)
SOX4NP_003098.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 3/16 (19%)
SOX-TCF_HMG-box 58..129 CDD:238684 24/70 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..228 23/117 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..286 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..416 34/143 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.