DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and sox7

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001016326.1 Gene:sox7 / 549080 XenbaseID:XB-GENE-488067 Length:362 Species:Xenopus tropicalis


Alignment Length:403 Identity:81/403 - (20%)
Similarity:122/403 - (30%) Gaps:157/403 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1231 KIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKL 1295
            :|||||||||:::|..||.:..::|:..|..:||:||:.|.||.|.||..|.|.|..::..|.:.
 Frog    41 RIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQHMQD 105

  Fly  1296 HPEWKWCSKDRRKSSTSTATPGGKASGAAGTGDAKQRLVSVDGSDSLEHDMCPSTPGGSGSCGGQ 1360
            :|.:|:  :.|||.....                                :|.....|.      
 Frog   106 YPNYKY--RPRRKKQIKR--------------------------------ICKRVDTGF------ 130

  Fly  1361 GISSDLQGDIIPLTIDNYNSTCDEAPTTISMKGNGNGKLMKNELPSDEDEQMLVVEEEQQQQTVK 1425
             :.|.|..|        .||..|......:::...||....:.||                    
 Frog   131 -LLSSLSRD--------QNSVPDTRGCRTAVEKEENGGYPGSALP-------------------- 166

  Fly  1426 KIDL-HCRERVNDSDMDDTPFDYRKQQP------EANQRSAEEHSTSGANGQAINAPPLSGGERE 1483
              |: |.||..::....|..:.|....|      ||..:....:||                   
 Frog   167 --DMRHYRETPSNGSKHDQTYPYGLPTPPEMSPLEAIDQDQSFYST------------------- 210

  Fly  1484 ITLKPKAIKAHPVLESNMLPYTQMSIYTQYTSPKNPIGVTPFQPTGGAFKSMPISPKGSGGKPED 1548
                |.:...||.:...:..|          |.::||                            
 Frog   211 ----PCSEDCHPHINGAVYEY----------SSRSPI---------------------------- 233

  Fly  1549 AGSLQAHIKQEDIKQEPPSPYKLNNGSGSASGGGVVSAPPPNSGSVGAIFNFNVPTATALSQKQF 1613
               |.:|:.|..|.|           :||:....|.:.||....|.....:.|......    |.
 Frog   234 ---LCSHLSQVPIPQ-----------TGSSMIPPVPNCPPAYYSSTYHSIHHNYHAHLG----QL 280

  Fly  1614 HYPMHHPHRSPTD 1626
            ..|..|||....|
 Frog   281 SPPPEHPHYDAID 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 30/70 (43%)
sox7NP_001016326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41 81/403 (20%)
SOX-TCF_HMG-box 41..112 CDD:238684 30/72 (42%)
Sox17_18_mid 171..218 CDD:371880 10/69 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.