DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and Sox2

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001102651.1 Gene:Sox2 / 499593 RGDID:1565646 Length:319 Species:Rattus norvegicus


Alignment Length:380 Identity:91/380 - (23%)
Similarity:145/380 - (38%) Gaps:99/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1214 QQQAGAAG-----TAAGQPANKK-----IRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGE 1268
            ||.:|..|     |||....|:|     ::|||||||::|:..|:.:.:::|...|..:||.||.
  Rat    15 QQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGA 79

  Fly  1269 WWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSST-----STATPGGKASGAAGTGD 1328
            .|..|...:|..:.:.|..::..|.|.||::|:  :.|||:.|     ....|||..:       
  Rat    80 EWKLLSETEKRPFIDEAKRLRALHMKEHPDYKY--RPRRKTKTLMKKDKYTLPGGLLA------- 135

  Fly  1329 AKQRLVSVDGSDSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNSTCDEAPTTISMKG 1393
                                  |||:....|.|:.:.| |..:...:|:|          ..|.|
  Rat   136 ----------------------PGGNSMASGVGVGAGL-GAGVNQRMDSY----------AHMNG 167

  Fly  1394 --NGNGKLMKNELPSDEDEQMLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDYRKQQPEANQ 1456
              ||:..:|:.:|...: ...|......|.|.:.:.|:...: .|......|   |....|..:.
  Rat   168 WSNGSYSMMQEQLGYPQ-HPGLNAHGAAQMQPMHRYDVSALQ-YNSMTSSQT---YMNGSPTYSM 227

  Fly  1457 RSAEEHSTSGANGQAINAPPLSGGEREITLKPKAIKAHPVLESNMLPYTQMSIYTQYTSPKNPIG 1521
                .:|..|..|.|:       |.....:|.:|..:.||:.|        |.:::         
  Rat   228 ----SYSQQGTPGMAL-------GSMGSVVKSEASSSPPVVTS--------SSHSR--------- 264

  Fly  1522 VTPFQPTGGAFKSMPISPKGSGGK-PEDAGSLQAHIKQEDIKQEPPSPYKLNNGS 1575
             .|.|  .|..:.| ||....|.: ||.|...:.|:.|.  .|..|.|....||:
  Rat   265 -APCQ--AGDLRDM-ISMYLPGAEVPEPAAPSRLHMAQH--YQSGPVPGTAINGT 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 25/75 (33%)
Sox2NP_001102651.1 SOX-TCF_HMG-box 42..113 CDD:238684 24/72 (33%)
SOXp 112..202 CDD:403523 25/132 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.