DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and sox3

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001007502.1 Gene:sox3 / 493228 XenbaseID:XB-GENE-484815 Length:307 Species:Xenopus tropicalis


Alignment Length:354 Identity:81/354 - (22%)
Similarity:128/354 - (36%) Gaps:104/354 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1211 QQQQQQAGAAGTAAGQ-----PANKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWW 1270
            ||.....|..||..|:     |..::::|||||||::|:..|:.:.:::|...|..:||.||..|
 Frog    14 QQSNAPNGGPGTPGGKGNASIPDQERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADW 78

  Fly  1271 YALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGKASGAAGTGDAKQRLVS 1335
            ..|...:|..:.:.|..::..|.|.:|::|:  :.|||:.|.                .|:...|
 Frog    79 KLLSDSEKRPFIDEAKRLRAVHMKEYPDYKY--RPRRKTKTL----------------LKKDKYS 125

  Fly  1336 VDGSDSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNSTCDEAPTTISMKG--NGNGK 1398
            :.|:        ...||.|......|:..         .||.|          ..|.|  ||...
 Frog   126 LPGN--------LLAPGVSPVASSVGVGQ---------RIDTY----------AHMNGWTNGAYS 163

  Fly  1399 LMKNELPSDEDEQMLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDYR-------KQQPEANQ 1456
            ||:::|...:...|   ...|.||...:.|:   ..:..|.|..:...|.       ...|..||
 Frog   164 LMQDQLGYSQHPGM---NSPQMQQIQHRYDM---GGLQYSPMMSSAQTYMNAAASTYSMSPAYNQ 222

  Fly  1457 RSAEEHSTSGANGQAINAPPLSGGEREITLKPKAIKAH--------------------------P 1495
            :|:...|. |:.|..:.:.|.|        .|.||.:|                          .
 Frog   223 QSSTVMSL-GSMGSVVKSEPSS--------PPPAITSHTQRACLGDLRDMISMYLPPGGDASDPS 278

  Fly  1496 VLESNMLPYTQMSIYTQYTSPKNPIGVTP 1524
            .|:|:.|    .|::..|.|...|.|..|
 Frog   279 SLQSSRL----HSVHQHYQSAAGPNGTVP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 23/70 (33%)
sox3NP_001007502.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 7/26 (27%)
SOX-TCF_HMG-box 39..110 CDD:238684 23/72 (32%)
SOXp 109..189 CDD:372055 25/127 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.