DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and D

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster


Alignment Length:354 Identity:80/354 - (22%)
Similarity:133/354 - (37%) Gaps:87/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1073 LQQQQQL-----QQQQQSPPQMPLN-----HNNNHLIVSAPLSSPGKPLNCSMNDAKVAAAAAAA 1127
            |.|.|.|     |.|.|..|.|.::     |.:..|  :|...||..|....:|.:.......::
  Fly    14 LGQAQGLEDYAPQSQLQLSPGMDMDIKRVLHYSQSL--AAMGGSPNGPAGQGVNGSSGMGHHMSS 76

  Fly  1128 AVANQRQKQQQEEPDDQLDDDVFETTTPGISANSKKQTAAMRLPTHNSNIRKLEECHDDGAAGA- 1191
            .:......|                      |.|.:||.     :.||:|         |:||: 
  Fly    77 HMTPHHMHQ----------------------AVSAQQTL-----SPNSSI---------GSAGSL 105

  Fly  1192 PATSAAKRRSQSLSALQQQQQQQQQAG--AAGTAAGQPANKKIRRPMNAFMIFSKKHRKMVHKKH 1254
            .:.|:.......|::    ....|.||  :..|:.||..:  |:|||||||::|:..|:.:.|.:
  Fly   106 GSQSSLGSNGSGLNS----SSGHQSAGMHSLATSPGQEGH--IKRPMNAFMVWSRLQRRQIAKDN 164

  Fly  1255 PNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGK 1319
            |...|..:||.||..|..|...:|..:.:.|..::..|.|.||::|:..:.:.|:..:....||.
  Fly   165 PKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGGL 229

  Fly  1320 ASGAAGTGDAKQRLVSVDGSDSLEHDMCPSTPGGSGSCG---------------GQGISSDLQGD 1369
            ...|.|.|  :|:|.:..|:             |:|...               .||......|.
  Fly   230 QMQAGGMG--QQKLGAGPGA-------------GAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGG 279

  Fly  1370 IIPLTIDNYNSTCDEAPTTISMKGNGNGK 1398
            ..||.:...:.:...|...::.:|...|:
  Fly   280 FDPLALSKLHQSQAAAAAAVNNQGQQQGQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 26/70 (37%)
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3058
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.