DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and Sox18

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001019952.1 Gene:Sox18 / 311723 RGDID:1311718 Length:377 Species:Rattus norvegicus


Alignment Length:321 Identity:80/321 - (24%)
Similarity:127/321 - (39%) Gaps:67/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1187 GAA----GAPATSAAKRRSQSLSALQQQQQQQQQAGAAGTAAG--QPANK-KIRRPMNAFMIFSK 1244
            |||    |.|.|:.:.....|.|:|.:...:..::|..|...|  |.|:: :|||||||||:::|
  Rat    27 GAAAEPRGLPVTNVSPTSPASPSSLPRSPPRSPESGRYGFGRGERQTADELRIRRPMNAFMVWAK 91

  Fly  1245 KHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKS 1309
            ..||.:.:::|:..|..:||:||:.|..|...:|..:.|.|..::..|.:.||.:|:  :.|||.
  Rat    92 DERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDHPNYKY--RPRRKK 154

  Fly  1310 S-------------------TSTATPGGKASGAA--------------GTGDAKQRLVSVDGSDS 1341
            .                   ::...|...|||:|              |.|........:||.:|
  Rat   155 QARKVRRLEPGLLLPGLVQPSAPPEPFAAASGSARSFRELPTLGAEFDGLGLPTPERSPLDGLES 219

  Fly  1342 LEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNSTCDE----APTTISMKGNGNGKL--- 1399
            .|....| .|.....|..:...:....::.......|.|:..|    ||....:.|...|.|   
  Rat   220 GEASFFP-PPLAPEDCALRAFRAPYAPELARDPSFCYGSSLAEALRTAPPAAPLAGLYYGTLGTP 283

  Fly  1400 --MKNELPSDEDEQMLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDY----RKQQPEA 1454
              ..|.|....:...|    |..:|.....||.       :|:|.|.||.    .:.:|:|
  Rat   284 GPFPNPLSPPPEAPSL----EGTEQLEPTADLW-------ADVDLTEFDQYLNCSRTRPDA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 27/70 (39%)
Sox18NP_001019952.1 SOX-TCF_HMG-box 78..149 CDD:238684 27/72 (38%)
Sox17_18_mid 191..239 CDD:403331 9/48 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.