DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and sox17

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_571362.2 Gene:sox17 / 30544 ZFINID:ZDB-GENE-991213-1 Length:413 Species:Danio rerio


Alignment Length:421 Identity:98/421 - (23%)
Similarity:159/421 - (37%) Gaps:82/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1204 LSALQQQQQQQQQAGAAGTAAGQPANKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGE 1268
            ||.|...:.:.::..|||...|: :..:|||||||||:::|..||.:.:::|:..|..:||:||:
Zfish    36 LSPLSDSKSKHEKCSAAGPGRGK-SEPRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGK 99

  Fly  1269 WWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGKASGAAGTGDAKQRL 1333
            .|.||....|..:.|.|..::..|.:.||.:|:  :.||:...........:....|..|||..|
Zfish   100 SWKALPMVDKRPFVEEAERLRVKHMQDHPNYKY--RPRRRKQVKRNKRLEPSFPLPGMCDAKMTL 162

  Fly  1334 VSVDGSDSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYN-STCDEAP----TTISMKG 1393
                         |  |.|.|....|.|:....:...:   .::|: .|.|.:|    ||...  
Zfish   163 -------------C--TEGMSAGYSGAGLPQYCENHTL---FESYSLPTPDPSPMDAGTTEFF-- 207

  Fly  1394 NGNGKLMKNELPSDEDEQMLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDYRKQQPEANQRS 1458
               .:|......|...:|    |...|:||....|.||.....                  ..:|
Zfish   208 ---AQLQDQSAFSYHHQQ----EHHFQEQTNILNDTHCHGNTQ------------------TLKS 247

  Fly  1459 AEEHSTSGANGQAINAPPLSGGEREITLKPKAIKAHPVLESNMLPY------TQMSIYTQYTSPK 1517
            .:.||.:.:|   ||....|.....|..:..:|....|...|..|.      |.::|:.:..|..
Zfish   248 RQSHSIAYSN---INTNTNSNLHAPINAQLSSINLQQVFHENANPQISHHPGTHLNIFNRSPSSS 309

  Fly  1518 NPIGVTPFQPTGGAFKSMPIS----PKGSGGKPEDAGSLQAHI-KQEDIKQEPPSPYKLNNGSGS 1577
            :...:||      |:.:.|.:    ...|....|.:..:.:|. ||:.|.:.........:.||.
Zfish   310 SHHAMTP------AYLNCPSTLDTFYNSSSQMKELSHCVSSHTHKQQSIAEAQSQASTATHSSGQ 368

  Fly  1578 ---------ASGGGVVSAPPPNSGSVGAIFN 1599
                     ....||.|||.|.|..:..:.:
Zfish   369 MVDEVEFEHCLSFGVPSAPLPGSDLISTVLS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 28/70 (40%)
sox17NP_571362.2 SOX-TCF_HMG-box 62..133 CDD:238684 28/72 (39%)
Sox_C_TAD 186..411 CDD:288887 50/250 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.