DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and sox3

DIOPT Version :9

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001001811.2 Gene:sox3 / 30529 ZFINID:ZDB-GENE-980526-333 Length:300 Species:Danio rerio


Alignment Length:131 Identity:42/131 - (32%)
Similarity:67/131 - (51%) Gaps:14/131 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1214 QQQAGAAGTAAGQPAN--KKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPE 1276
            |...|:........||  .:::|||||||::|:..|:.:.:::|...|..:||.||..|..|...
Zfish    15 QSNTGSVTGGKNNSANDQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLTDA 79

  Fly  1277 QKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSST-----STATPGG-KASGAAGTGDAKQRLVS 1335
            :|..:.:.|..::..|.|.||::|:  :.|||:.|     ..:.||| .|.||....:|    ||
Zfish    80 EKRPFIDEAKRLRAMHMKEHPDYKY--RPRRKTKTLLKKDKYSLPGGLLAPGANAVNNA----VS 138

  Fly  1336 V 1336
            |
Zfish   139 V 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 24/70 (34%)
sox3NP_001001811.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 4/19 (21%)
SOX-TCF_HMG-box 34..105 CDD:238684 24/72 (33%)
SOXp 104..182 CDD:289133 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.