Sequence 1: | NP_001262755.1 | Gene: | cic / 53560 | FlyBaseID: | FBgn0262582 | Length: | 2150 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001335567.1 | Gene: | sox-4 / 182547 | WormBaseID: | WBGene00015716 | Length: | 260 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 41/205 - (20%) |
---|---|---|---|
Similarity: | 91/205 - (44%) | Gaps: | 37/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1153 TTPGISAN-------SKKQTAAMRLPTHNSNIRKLEECHDDGAAGAPATSAAKRRSQSL------ 1204
Fly 1205 -------------SALQQQQQQQQQAGAAGTAAGQPANKKIRRPMNAFMIFSKKHRKMVHKKHPN 1256
Fly 1257 QDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGKAS 1321
Fly 1322 GAAGTGDAKQ 1331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cic | NP_001262755.1 | DUF4819 | 349..431 | CDD:292708 | |
SOX-TCF_HMG-box | 1231..1302 | CDD:238684 | 23/70 (33%) | ||
sox-4 | NP_001335567.1 | SOX-TCF_HMG-box | 120..191 | CDD:238684 | 23/70 (33%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |