DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and lpxT

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_416679.4 Gene:lpxT / 946693 ECOCYCID:G7146 Length:237 Species:Escherichia coli


Alignment Length:272 Identity:58/272 - (21%)
Similarity:96/272 - (35%) Gaps:83/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LTDLCLLSCVGLPMLGFSLWGEAVKRGFFCD-DSSLRHPYRDSTMPS----WILYLM-------C 144
            |..:.||:.|||.:  |..|...|..||:.. |:.:.:.:....:.|    |::.|.       |
E. coli     5 LPQIVLLNIVGLAL--FLSWYIPVNHGFWLPIDADIFYFFNQKLVESKAFLWLVALTNNRAFDGC 67

  Fly   145 GALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVE-CYHRMGIFIFGLGVEQL 208
            ..|.:. ||::.|                              ||.| ...|..|.|.||  ..|
E. coli    68 SLLAMG-MLMLSF------------------------------WLKENAPGRRRIVIIGL--VML 99

  Fly   209 STNIAKYSIGRLRPHFYTLCQPVMKDGTTCS-DPINAARYIEEFTCAAVDITSKQLKD-MRLSFP 271
            .|.:....:|:       ...||.:...|.: ..||...          ::.|...|| .|.|||
E. coli   100 LTAVVLNQLGQ-------ALIPVKRASPTLTFTDINRVS----------ELLSVPTKDASRDSFP 147

  Fly   272 SGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSG 336
            ..|.         :::.:.....|:....:..|:  .|::|..: |..||....|.::|::.||.
E. coli   148 GDHG---------MMLLIFSAFMWRYFGKVAGLI--ALIIFVVF-AFPRVMIGAHWFTDIIVGSM 200

  Fly   337 ----IGLTYAVV 344
                |||.:.::
E. coli   201 TVILIGLPWVLL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 36/161 (22%)
lpxTNP_416679.4 acidPPc 98..210 CDD:214471 30/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.