DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and PLPP2

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_808211.1 Gene:PLPP2 / 8612 HGNCID:9230 Length:309 Species:Homo sapiens


Alignment Length:238 Identity:92/238 - (38%)
Similarity:126/238 - (52%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LPMLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILYLMCG-ALPLTVMLVV--EFFRGQDKR 164
            ||....:|.....||||:|.|.|:|:|||..|:...   ||.| .:..||:||.  |.:.....|
Human    41 LPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHG---LMAGVTITATVILVSAGEAYLVYTDR 102

  Fly   165 LHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQ 229
            |:|              ..:...::...|..:|.|:||..|.|..|::|||.||||||:|..:|.
Human   103 LYS--------------RSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCD 153

  Fly   230 PVMKDGTTCSDPINAARYIE-EFTCAA--VDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHR 291
            |   |.:.    :|.:.|:: |..|..  .|:|     :.||||.|||:||..|.|::|.:|:..
Human   154 P---DWSR----VNCSVYVQLEKVCRGNPADVT-----EARLSFYSGHSSFGMYCMVFLALYVQA 206

  Fly   292 RMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAG 334
            |:.||..|:|...:||.|:.||.|...||||||||||||||.|
Human   207 RLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 66/147 (45%)
PLPP2NP_808211.1 PAP2_wunen 115..261 CDD:239479 66/147 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144682
Domainoid 1 1.000 156 1.000 Domainoid score I4177
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3741
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm8567
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X571
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.