DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and LCB3

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_012401.1 Gene:LCB3 / 853307 SGDID:S000003670 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:43/194 - (22%)
Similarity:73/194 - (37%) Gaps:52/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RMGIFIFGLGVEQL-STNIAKYSIGR-------------------LRPH-FYTLCQPV------- 231
            ||..|.|.:..:.| .||...:::.|                   :..| ||.||.|:       
Yeast    43 RMSKFRFNIREKLLVFTNNQSFTLSRWQKKYRSAFNDLYFTYTSLMGSHTFYVLCLPMPVWFGYF 107

  Fly   232 --MKD-----GTTCSDPINAARYIEEFTCAAVD-------ITSKQLKDMRLSFPSGHASFAC-YS 281
              .||     |.:    |..:.:.:::.|....       ||..:........||.|.:.|. .|
Yeast   108 ETTKDMVYILGYS----IYLSGFFKDYWCLPRPRAPPLHRITLSEYTTKEYGAPSSHTANATGVS 168

  Fly   282 MLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYT-ALTRVSDYKHHWSDVLAGSGIGLTYAVV 344
            :|:|  |...|||  :..::..||...:::|.:.| ...|:....|...|:::|..||:...:|
Yeast   169 LLFL--YNIWRMQ--ESSVMVQLLLSCVVLFYYMTLVFGRIYCGMHGILDLVSGGLIGIVCFIV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 43/194 (22%)
LCB3NP_012401.1 PAP2_SPPase1 77..230 CDD:239482 35/160 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.