DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and LPPepsilon2

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001331932.1 Gene:LPPepsilon2 / 836777 AraportID:AT5G66450 Length:308 Species:Arabidopsis thaliana


Alignment Length:161 Identity:36/161 - (22%)
Similarity:69/161 - (42%) Gaps:29/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARY--IEEFTCAAVDITSKQLK 264
            |.|:|.::..::|:.:..|......|    ..||        ||.:  |...:.:.:.:..|::.
plant   101 GDGIEAIANRLSKWIVAALFGSVLLL----RHDG--------AALWAVIGSVSNSVLSVALKRIL 153

  Fly   265 DMRL---------SFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQ-FLLLMFAWYTALT 319
            :...         ..||.||....:..::.|..:   |:|....:|...|. |:|.:.:::|.| 
plant   154 NQERPVATLRSDPGMPSSHAQSISFISVFSVFSV---MEWLGTNVLSLFLSGFILALGSYFTWL- 214

  Fly   320 RVSDYKHHWSDVLAGSGIGLTYAVV-VTSTM 349
            |||...|..|.|:.|:.:|..|:.: ||:.:
plant   215 RVSQKLHTTSQVVVGAIVGSVYSTLCVTNAV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 34/156 (22%)
LPPepsilon2NP_001331932.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.