DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and LPPepsilon1

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_190661.2 Gene:LPPepsilon1 / 824256 AraportID:AT3G50920 Length:279 Species:Arabidopsis thaliana


Alignment Length:162 Identity:35/162 - (21%)
Similarity:64/162 - (39%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 IFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARY--IEEFTCAAVDITSKQ 262
            :.|.|:|.:...::|:.:..|......|    ..||        ||.:  |...:.:|:.:..|:
plant    92 VTGGGIEAIVNRLSKWVVSVLFGSIILL----RHDG--------AALWAVIGSISNSALSVVLKR 144

  Fly   263 LKDMRL---------SFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTAL 318
            :.:...         ..||.||....:..::.|:.:   |:|.....:...|..|:|....|...
plant   145 ILNQERPTTTLRSDPGMPSSHAQSISFISVFAVLSV---MEWLGTNGVSLFLSGLILALGSYFIR 206

  Fly   319 TRVSDYKHHWSDVLAGSGIGLTYAVVVTSTMW 350
            .|||...|..|.|:.|:.:|..:. ::..|||
plant   207 LRVSQKLHTSSQVVVGAIVGSLFC-ILWYTMW 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 32/156 (21%)
LPPepsilon1NP_190661.2 PAP2_dolichyldiphosphatase 100..234 CDD:239477 29/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.