DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and LPP4

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_566602.1 Gene:LPP4 / 821350 AraportID:AT3G18220 Length:308 Species:Arabidopsis thaliana


Alignment Length:227 Identity:60/227 - (26%)
Similarity:101/227 - (44%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SSLRHPYRDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTW 188
            :.|..|:.:.|:|.|.:.::|..:|:.:.:|..::|.....||..                    
plant    55 TDLTFPFYEDTIPMWAVPIICILVPICIFIVYYYYRRDVYDLHHA-------------------- 99

  Fly   189 LVECYHRMGIFIFGLG----VEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIE 249
                       |.|:|    |..::|:..|.::||.||:|:..|.|   :|.....|..     :
plant   100 -----------ILGIGFSCLVTGVTTDSIKDAVGRPRPNFFYRCFP---NGKPKFHPDT-----K 145

  Fly   250 EFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLR----MLCHLLQFLLL 310
            :..|..|   .|.:|:...||||||.|::...:.:|..||..:::....|    .||  |.||.:
plant   146 DVVCHGV---KKIIKEGYKSFPSGHTSWSFAGLTFLAWYLSGKIKVFDRRGHVAKLC--LVFLPI 205

  Fly   311 MFAWYTALTRVSDYKHHWSDVLAGSGIGLTYA 342
            :.:....::||.||.|||:||.||:.||:..|
plant   206 LISILIGISRVDDYWHHWTDVFAGAIIGIFVA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 49/160 (31%)
LPP4NP_566602.1 PgpB 23..246 CDD:223743 60/227 (26%)
PAP2_containing_1_like 55..244 CDD:239484 60/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.