DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wun2 and SGPP1

DIOPT Version :9

Sequence 1:	NP_524991.1	Gene:	wun2 / 53558	FlyBaseID:	FBgn0041087	Length:	350	Species:	Drosophila melanogaster
Sequence 2:	NP_110418.1	Gene:	SGPP1 / 81537	HGNCID:	17720	Length:	441	Species:	Homo sapiens

Alignment Length:	84	Identity:	19/84 - (22%)
Similarity:	36/84 - (42%)	Gaps:	13/84 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   269 SFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAW--YTALTRVSDYKHHWSDV 331
            |.||.||.......:.:|:..:.|.|:.       |:..|:|:..|  ...|:|:....|...|:
Human   203 SMPSTHAMSGTAIPISMVLLTYGRWQYP-------LIYGLILIPCWCSLVCLSRIYMGMHSILDI 260

  Fly   332 LAGSGIGLTYAVVVTSTMW 350
            :|    |..|.:::.:..:
Human   261 IA----GFLYTILILAVFY 275

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wun2	NP_524991.1	PAP2_wunen	191..346	CDD:239479	19/78 (24%)
SGPP1	NP_110418.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	25..110
		PAP2_SPPase1	126..275	CDD:239482	19/82 (23%)
		Phosphatase sequence motif I. /evidence=ECO:0000305	178..186
		Phosphatase sequence motif II. /evidence=ECO:0000305	205..208		2/2 (100%)
		Phosphatase sequence motif III. /evidence=ECO:0000305	248..259		2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0671
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900