DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wun2 and Sgpp1

DIOPT Version :9

Sequence 1:	NP_524991.1	Gene:	wun2 / 53558	FlyBaseID:	FBgn0041087	Length:	350	Species:	Drosophila melanogaster
Sequence 2:	NP_109675.1	Gene:	Sgpp1 / 81535	MGIID:	2135760	Length:	430	Species:	Mus musculus

Alignment Length:	79	Identity:	19/79 - (24%)
Similarity:	33/79 - (41%)	Gaps:	13/79 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   269 SFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAW--YTALTRVSDYKHHWSDV 331
            |.||.||.......:.:.:..:.|.|:.       |:..|:|:..|  ...|:|:....|...||
Mouse   192 SMPSTHAMSGTAIPIAMFLLTYGRWQYP-------LIYGLILIPCWSSLVCLSRIYMGMHSILDV 249

  Fly   332 LAGSGIGLTYAVVV 345
            :|    |..|.:::
Mouse   250 IA----GFLYTILI 259

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wun2	NP_524991.1	PAP2_wunen	191..346	CDD:239479	19/79 (24%)
Sgpp1	NP_109675.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	34..103
		PgpB	<117..273	CDD:223743	19/79 (24%)
		PAP2_SPPase1	117..264	CDD:239482	19/79 (24%)
		Phosphatase sequence motif I. /evidence=ECO:0000305	167..175
		Phosphatase sequence motif II. /evidence=ECO:0000305	194..197		2/2 (100%)
		Phosphatase sequence motif III. /evidence=ECO:0000305	237..248		2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0671
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900