DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and PLPPR3

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_079164.1 Gene:PLPPR3 / 79948 HGNCID:23497 Length:746 Species:Homo sapiens


Alignment Length:294 Identity:72/294 - (24%)
Similarity:127/294 - (43%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LCLLSC---VGLPMLGFSLWG----------EAVKRGFFCDDSSLRHPY---RDSTMPSWILYLM 143
            :.||.|   |.||::..|:..          :..|.||.|.|.:|..||   .:..:|..:|..:
Human    15 MTLLPCFYFVELPIVASSIVSLYFLELTDLFKPAKVGFQCYDRTLSMPYVETNEELIPLLMLLSL 79

  Fly   144 CGALPLTVMLVVE--FFRGQDK---RLHSPF-PKSTMCSGYHLCHLELPTWLVECYHRMGIFIFG 202
            ..|.|...::|.|  .:..|.:   |...|. .:.::.:|.  |:..  ::|......:|:.:||
Human    80 AFAAPAASIMVAEGMLYCLQSRLWGRAGGPAGAEGSINAGG--CNFN--SFLRRTVRFVGVHVFG 140

  Fly   203 LGVEQLSTNIAKYSIGRLRPHFYTLCQP-VMKDGTTCSDPINAARYIEEFTCAAVDITSKQLKDM 266
            |....|.|::.:.:.|...|.|.|:|:| ....||:|.  :|.  ||.:..|:..||.:  :...
Human   141 LCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCE--VNP--YITQDICSGHDIHA--ILSA 199

  Fly   267 RLSFPSGHASFACYSMLYL-----------VIYLHR-----------RMQWKQL-----RMLCHL 304
            |.:|||.||:.:.::.:|:           .:.|.|           :|.:..:     ::|..:
Human   200 RKTFPSQHATLSAFAAVYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTTKLLKPI 264

  Fly   305 LQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIG 338
            |.|...:.|....||:::.|:.|..||.||..||
Human   265 LVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 45/176 (26%)
PLPPR3NP_079164.1 PAP2_wunen 129..306 CDD:239479 45/176 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144675
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.