DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plpp5

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_082276.1 Gene:Plpp5 / 71910 MGIID:1919160 Length:260 Species:Mus musculus


Alignment Length:230 Identity:72/230 - (31%)
Similarity:99/230 - (43%) Gaps:61/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RHPYRDST-MPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLV 190
            |:||.::. .|:..::::....||:::.:.:|.|..|..     .....|....|          
Mouse    42 RNPYVEAEYFPTGRMFVIAFLTPLSLIFLAKFLRKADAT-----DSKQACLAASL---------- 91

  Fly   191 ECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAA 255
                       .|.:..:.|||.|..:||.||.|:..|.|   ||...||          .||..
Mouse    92 -----------ALALNGVFTNIIKLIVGRPRPDFFYRCFP---DGLAHSD----------LTCTG 132

  Fly   256 -VDITSKQLKDMRLSFPSGHASFA----CYSMLYLVIYLH------RRMQWKQLRMLCHLLQFLL 309
             .|:    :.:.|.||||||:|||    .::..||...||      |...|:    ||..|..||
Mouse   133 DEDV----VNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWR----LCAFLSPLL 189

  Fly   310 LMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVV 344
              ||...||:|..||||||.|||.||.||:|:|.|
Mouse   190 --FAAVIALSRTCDYKHHWQDVLVGSMIGMTFAYV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 61/165 (37%)
Plpp5NP_082276.1 PAP2_containing_1_like 39..227 CDD:239484 72/230 (31%)
Phosphatase sequence motif I. /evidence=ECO:0000250|UniProtKB:Q8NEB5 104..112 3/7 (43%)
Phosphatase sequence motif II. /evidence=ECO:0000250|UniProtKB:Q8NEB5 145..148 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000250|UniProtKB:Q8NEB5 197..207 6/9 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2488
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.620

Return to query results.
Submit another query.