DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and PLPPR2

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001380821.1 Gene:PLPPR2 / 64748 HGNCID:29566 Length:452 Species:Homo sapiens


Alignment Length:248 Identity:70/248 - (28%)
Similarity:113/248 - (45%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RGFFCDDSSLRHPY----RDSTMPSWILYLMCGALP-LTVMLVVEFFRGQDKRLHSPFP------ 170
            :||||.||:...||    ..|.:|..::|.:..|.| ||::|      |:..|...|.|      
Human    47 QGFFCYDSTYAKPYPGPEAASRVPPALVYALVTAGPTLTILL------GELARAFFPAPPSAVPV 105

  Fly   171 --KSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMK 233
              :||:.|| ..|....|...:..:  :|::.|||....:..|..:...|...|||.::|:| ..
Human   106 IGESTIVSG-ACCRFSPPVRRLVRF--LGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRP-NY 166

  Fly   234 DGTTCSDPI----NAARYI-EEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRM 293
            ....|..|.    ...|:: ::..||.   :...:...|.:||...|:...|::.|..:|:....
Human   167 TALGCLPPSPDRPGPDRFVTDQGACAG---SPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVF 228

  Fly   294 QWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVT 346
            :.|..|::...|...||..|:...:.||::|::||||||||.   ||.|.:.|
Human   229 RVKGSRLVKPSLCLALLCPAFLVGVVRVAEYRNHWSDVLAGF---LTGAAIAT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 43/159 (27%)
PLPPR2NP_001380821.1 PAP2_wunen 125..281 CDD:239479 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.