DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and LOC571722

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_009295825.1 Gene:LOC571722 / 571722 -ID:- Length:746 Species:Danio rerio


Alignment Length:281 Identity:77/281 - (27%)
Similarity:122/281 - (43%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ILTDLCLLSC---VGLPMLGFSL-------WGE---AVKRGFFCDDSSLRHPYRDST---MPSWI 139
            |...:.||.|   |.||:|..|:       |.:   .|:.||.|.|.||..||.|.|   :|..:
Zfish    12 IKESVTLLPCFYFVELPLLVSSVVSVYFLEWTDIFKPVRWGFSCHDRSLSLPYIDPTHEVIPFLM 76

  Fly   140 LYLMCGALPLTVMLVVE------FFRGQDKRLHSPFPKSTMCSG-----YHLCHLELPTWLVECY 193
            |..:..|.|...:::.|      ..|.|             |.|     .:.......:::....
Zfish    77 LLSLAFAAPAITIMIGEGILFCCLSRAQ-------------CGGGAEADINAAGCNFNSFVRRGV 128

  Fly   194 HRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKD-GTTCSDPINAARYIEEFTCAAVD 257
            ..:|:.:|||.|..|.|:|.:.|.|...|:|.|:|:|.... .|:|.:..    :|.|..|:..|
Zfish   129 RFVGVHVFGLCVTALITDIIQLSTGYPAPYFLTVCKPNYTHLNTSCEESF----FILEDICSGPD 189

  Fly   258 ITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVS 322
              :..:...|.||||.||:.|.::.:|:.:|.:..:. ...::|..||.|..::.|....|||:.
Zfish   190 --AALINASRKSFPSQHATLASFAAVYVSMYFNSTLT-DSSKLLKPLLVFSFIICAIICGLTRII 251

  Fly   323 DYKHHWSDV----LAGSGIGL 339
            .:|:|..||    |.|.||.:
Zfish   252 QHKNHAIDVYLGFLLGGGIAV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 47/154 (31%)
LOC571722XP_009295825.1 PgpB 65..293 CDD:223743 58/228 (25%)
PAP2_wunen 126..275 CDD:239479 47/154 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.