DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Dolpp1

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_065062.1 Gene:Dolpp1 / 57170 MGIID:1914093 Length:238 Species:Mus musculus


Alignment Length:193 Identity:47/193 - (24%)
Similarity:72/193 - (37%) Gaps:50/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 HSPFPKSTMCSGYHLCHLEL-PTWLVECYHRMGI---------FIFGLGVEQLSTNIAKYSIGRL 220
            |..:|...: ||:.|.:|.| |.::|..:..:.|         |:.||.:.|....:.|:.|...
Mouse    20 HVEYPAGDL-SGHLLAYLSLSPIFVVVGFLTLIIFKRELHTISFLGGLALNQGVNWLIKHVIQEP 83

  Fly   221 RPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITSKQLKDMRLSFPSGHAS----FACYS 281
            ||               |..|..|.                   ..:...||.|:.    |:.||
Mouse    84 RP---------------CGGPHTAV-------------------GTKYGMPSSHSQFMWFFSVYS 114

  Fly   282 MLYLVIYLHRRMQWKQLRMLC-HLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAV 343
            .|:|.:.:|:....:.|.:|. |:|...||..|:..:.:||....|.||.|..|...|...||
Mouse   115 FLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMAV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 38/167 (23%)
Dolpp1NP_065062.1 PgpB 9..184 CDD:223743 47/193 (24%)
PAP2_dolichyldiphosphatase 16..180 CDD:239477 47/193 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.