DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plpp2a

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_692261.6 Gene:plpp2a / 563806 ZFINID:ZDB-GENE-140703-2 Length:287 Species:Danio rerio


Alignment Length:258 Identity:86/258 - (33%)
Similarity:136/258 - (52%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ILTDLCLLSCVGLPMLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILYLMCGALPLTVMLVV 155
            :|.||..::.|.:|.:..::......||.:|:|.::::|||    |..|.:.|..|:.::..:::
Zfish    12 VLMDLLCVAVVAMPFIIMTIMYRPYHRGVYCNDETIQYPYR----PDTISHKMMAAVTISCSVII 72

  Fly   156 ----EFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYS 216
                |.:....|||:|              :.:...:....|..:|.|:||..|.|..|::|||:
Zfish    73 IISGEAYLVYTKRLYS--------------NSDFNQYAAALYKVVGTFLFGACVSQSLTDMAKYT 123

  Fly   217 IGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITSKQLKDMRLSFPSGHASFACYS 281
            ||||||:|.::|.|.:.:|           |:.|..|..   .::.:.:.||||.|||:||..|.
Zfish   124 IGRLRPNFMSVCAPAVCEG-----------YMLEINCTG---NARNVTESRLSFYSGHSSFGMYC 174

  Fly   282 MLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVV 344
            ||:|.:|:..|:..|..|:|...:||.|:.||.|...|||||||||||||:.|...|...||:
Zfish   175 MLFLALYVQARLASKWARLLRPTIQFFLVAFAIYVGYTRVSDYKHHWSDVVVGLLQGALVAVL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 65/154 (42%)
plpp2aXP_692261.6 PAP2_wunen 98..239 CDD:239479 65/154 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577863
Domainoid 1 1.000 160 1.000 Domainoid score I4013
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3720
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm6463
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X571
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.