DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and sgpp1a

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_684347.1 Gene:sgpp1a / 556439 ZFINID:ZDB-GENE-030131-4695 Length:436 Species:Danio rerio


Alignment Length:150 Identity:33/150 - (22%)
Similarity:47/150 - (31%) Gaps:45/150 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LQLPTFVDSTRSQGSLYAVASNKKP-------------PLRGPRQIFG-RILTDLCLLSCVGLPM 105
            :::..|.:|..|..|.:|::....|             |.     :|| .|.....:|.|:....
Zfish   187 VKVEVFYNSEYSMPSTHAMSGTALPFSLFLLTCSRWEYPF-----MFGLSIALFWSILVCISRIY 246

  Fly   106 LGFSLWGEAVKRGFFCDDSSLR--HPYRDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSP 168
            :|.....|.: .||......|.  ||..|...   ..||.....||.|:||           |  
Zfish   247 MGMHSVLEVI-TGFLYSVLILAVLHPMLDDID---TFYLSHSYAPLVVLLV-----------H-- 294

  Fly   169 FPKSTMCSGYHLCHLELPTW 188
                   .|:.|....|.||
Zfish   295 -------VGFSLVAFSLDTW 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479
sgpp1aXP_684347.1 PAP2_SPPase1 121..270 CDD:239482 17/88 (19%)
PgpB <122..281 CDD:223743 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.