DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and slc38a9

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001011337.1 Gene:slc38a9 / 496801 XenbaseID:XB-GENE-5823434 Length:554 Species:Xenopus tropicalis


Alignment Length:293 Identity:56/293 - (19%)
Similarity:90/293 - (30%) Gaps:104/293 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LYAVASNKKPPLRGPRQIFGRILTDLCLLSCVGLPM--LGFSL---WGEAVKRGFFCDDSSLRHP 129
            |..:.|.:.|.......|.|.: :.:.|:|.|.|..  |||.|   |.:.  :.||..:..|..|
 Frog   292 LLPLLSFRSPSFFAKFNILGTV-SIIYLVSLVTLKAAHLGFHLRFSWNQV--QEFFVPEFRLSFP 353

  Fly   130 -------------------------YRDSTMPSWILYLMCG---------------ALPLTVMLV 154
                                     .:::.....|.||:.|               :.||:...:
 Frog   354 QLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCI 418

  Fly   155 VEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMG----------IF--IFGLGVEQ 207
            .:.|...       ||.|.:.:  .:..:.|...::..|..:|          ||  |:......
 Frog   419 QQNFLDN-------FPSSDILA--FVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYPSVFHV 474

  Fly   208 LSTNIAKYSIGRLRPHFYTLCQPVMK-DGTTCSDPINAARYIEEFTCAAVDITSKQLKDMRLSFP 271
            |:.|||...:|.:...||.....::: .|..|                                 
 Frog   475 LALNIAVVGVGVIMARFYPNIGGIIRFSGAAC--------------------------------- 506

  Fly   272 SGHASFACYSMLYLVIYLHRRMQWKQLRMLCHL 304
             |.|....|..|..:|.||||.|.|...:|.|:
 Frog   507 -GLAFVFVYPSLIHMISLHRRGQLKVHSILIHV 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 27/127 (21%)
slc38a9NP_001011337.1 SLC5-6-like_sbd 108..520 CDD:382020 47/273 (17%)
Important for arginine binding and amino acid transport. /evidence=ECO:0000250|UniProtKB:Q08BA4 122..127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4216
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.