DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and apobec2

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001006722.1 Gene:apobec2 / 448374 XenbaseID:XB-GENE-5757448 Length:234 Species:Xenopus tropicalis


Alignment Length:137 Identity:31/137 - (22%)
Similarity:54/137 - (39%) Gaps:27/137 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ESQSSSGEEPSSPTASSIIAAASGPNHNNNNNVKLDLQLPTF--VDSTRSQGSLYAVASNKKPPL 81
            :::|.|.::|.:.|.:    |....|...|:..|...:||.|  |:.:|...|.:..      ..
 Frog     5 QNKSQSDKDPINDTGN----AEKPENGEGNSEKKEQEELPPFEIVEGSRIPASSFMF------QF 59

  Fly    82 RGPRQIFGRILTDLCLLSCVGLPMLGFSLWGEAVKRGFFCDDSSLRH---PYRDSTMPSWILYLM 143
            :......||..|.||.  .|..|.      |: |..|:..|:.:..|   .:..|.:|.   :|.
 Frog    60 KNVEYSSGRNKTILCY--TVERPE------GQ-VFHGYLEDEHASAHAEDAFFTSVLPQ---FLT 112

  Fly   144 CGALPLT 150
            .|::.:|
 Frog   113 SGSVTVT 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479
apobec2NP_001006722.1 APOBEC2 55..234 CDD:376193 17/83 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.