DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plpp5

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_005155353.1 Gene:plpp5 / 431758 ZFINID:ZDB-GENE-040704-54 Length:358 Species:Danio rerio


Alignment Length:231 Identity:68/231 - (29%)
Similarity:95/231 - (41%) Gaps:70/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HPYRDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVEC 192
            ||.:...:|:..::.:....||.|:.:..|.:...|.              .|....|...|...
Zfish   139 HPVKKDRVPTRFMFAIALFTPLLVIFLFAFLKQGGKG--------------DLKEASLAVTLTLV 189

  Fly   193 YHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTT-----CS-DPINAARYIEEF 251
            .:  |:|          ||..|.::||.||.|:..|.|   ||..     || ||          
Zfish   190 LN--GVF----------TNAVKLAVGRPRPDFFYRCFP---DGQMNPELHCSGDP---------- 229

  Fly   252 TCAAVDITSKQLKDMRLSFPSGHASFAC----YSMLYLVIYLH------RRMQWKQLRMLCHLLQ 306
                 |:    :.:.|.||||||:|||.    ::.||:...||      :...|:    ||..|.
Zfish   230 -----DV----VMEGRKSFPSGHSSFAFAGLGFTALYVAGKLHCFSTAGQGKAWR----LCAFLT 281

  Fly   307 FLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYA 342
            .||  ||...||:|..||||||.|||.||.:||.::
Zfish   282 PLL--FAILIALSRTCDYKHHWQDVLVGSLLGLVFS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 57/168 (34%)
plpp5XP_005155353.1 PAP2_containing_1_like 134..322 CDD:239484 68/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.