DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plppr1

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001002132.1 Gene:plppr1 / 415222 ZFINID:ZDB-GENE-040625-138 Length:333 Species:Danio rerio


Alignment Length:245 Identity:73/245 - (29%)
Similarity:113/245 - (46%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RGFFCDDSSLRHPY----RDSTMPSWILYLMCGALPLTVMLVVEF-----------FRGQDKRLH 166
            :||||:|:.|..||    ..|.:...|||.:..|.|..::.|.|.           ...|:|   
Zfish    45 QGFFCNDADLLKPYPGPEESSFIQPLILYCVVAAAPTAIIFVGEISMYIMKSTGEALLAQEK--- 106

  Fly   167 SPFPKSTMCSGYHLCHLELPTWLVECYHR-MGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQP 230
                  |:.:| ..|:|. |  |:....| :|:|.|||....:..|..:...|.|.|:|..:|:|
Zfish   107 ------TIVTG-ECCYLN-P--LIRRIIRFIGVFAFGLFATDIFVNAGQVVTGNLAPYFLNVCKP 161

  Fly   231 VMKDGTTCSDPINAARYIEEFTCAAVDITSKQ--LKDMRLSFPSGHASFACYSMLYLVIYLHRRM 293
             ...|..|       .:..:|.......|..|  ::..|.||||..||.:.||.:|:.:|:...:
Zfish   162 -NYTGLDC-------HFSHQFIANGNICTGNQVVVERARRSFPSKDASLSVYSAVYVTMYITSTI 218

  Fly   294 QWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAV 343
            :.|..|:...:|...||..|:.|.|.|||:|::|.|||:||..:|.:.|:
Zfish   219 KTKSSRLAKPVLCLGLLCAAFLTGLNRVSEYRNHCSDVVAGFILGSSIAL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 49/156 (31%)
plppr1NP_001002132.1 PAP2_wunen 122..271 CDD:239479 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.